PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1AS_1432A2F79.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 123aa    MW: 13730.3 Da    PI: 9.9678
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1AS_1432A2F79.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY97.49.5e-313593159
                           ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY  1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                           ldDg++WrKYG+K vk+s++pr+YYrC+ +gC vkk+ver+++dp++v++tY g Hnh 
  Traes_1AS_1432A2F79.1 35 LDDGFKWRKYGKKAVKNSPNPRNYYRCSAEGCGVKKRVERDRDDPRYVVTTYDGVHNHA 93
                           59********************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.3E-322395IPR003657WRKY domain
SuperFamilySSF1182903.01E-282795IPR003657WRKY domain
PROSITE profilePS5081131.5823095IPR003657WRKY domain
SMARTSM007747.6E-353594IPR003657WRKY domain
PfamPF031061.5E-243692IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0050832Biological Processdefense response to fungus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 123 aa     Download sequence    Send to blast
GAGDDEHRGE KKIKISARVS SGRIGFRTRS EVEILDDGFK WRKYGKKAVK NSPNPRNYYR  60
CSAEGCGVKK RVERDRDDPR YVVTTYDGVH NHATPGAAAQ YYCYSPPRSS PPAAYSAAGL  120
LQF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-292095277Probable WRKY transcription factor 4
2lex_A2e-292095277Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00531DAPTransfer from AT5G26170Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3571961e-168AK357196.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1048A03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002440727.13e-55hypothetical protein SORBIDRAFT_09g005700
SwissprotQ8VWQ54e-41WRK50_ARATH; Probable WRKY transcription factor 50
TrEMBLW4ZUX16e-87W4ZUX1_WHEAT; Uncharacterized protein
TrEMBLM7YJE03e-86M7YJE0_TRIUA; Putative WRKY transcription factor 50
STRINGMLOC_12079.11e-80(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44137206
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.12e-42WRKY DNA-binding protein 50
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]